PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017589.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 273aa    MW: 29360.3 Da    PI: 6.4322
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017589.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.88.9e-5566162197
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+ege+
  Pbr017589.1  66 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYREMEGER 162
                  69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.9E-5261174IPR009072Histone-fold
SuperFamilySSF471131.71E-3869166IPR009072Histone-fold
PfamPF008086.6E-2672136IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-16100118No hitNo description
PROSITE patternPS006850103119IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-16119137No hitNo description
PRINTSPR006151.6E-16138156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MTTPNTTSAS GLKLSDINVR PAEMNQYSMG MGRQTTTTTN VNNVFNNSSS NANTTNGTAD  60
DNECMVREQD RFMPIANVIR IMRKILPPHA KISDDAKETI QECVSEYISF ITGEANERCQ  120
REQRKTITAE DVLWAMSKLG FDDYIEPLTL YLHRYREMEG ERGSSTTSLM RSESLAKGAG  180
TSSGTSSRAI DHHQYYGSSM AAAAAAFHHQ HGHGFFGYMN PSDAWVSNNN VNAASAAAAS  240
GLSTQLQGGG SAAMLNGDHH QLPHANGANG GA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-4067157393NF-YB
4awl_B3e-4067157494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4067157494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374852.10.0PREDICTED: nuclear transcription factor Y subunit B-3
SwissprotQ84W667e-73NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0B2S6G84e-80A0A0B2S6G8_GLYSO; Nuclear transcription factor Y subunit B-6
TrEMBLB5KMS84e-80B5KMS8_SOYBN; Transcription factor LEC1-A
STRINGGLYMA07G39820.11e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-69nuclear factor Y, subunit B6